Vibrio cholerae O1 O395: VC395_0390 Help Entry VC395_0390        CDS       T02099                                  Name (GenBank) putative host factor I protein   KO K03666   host factor-I protein Organism vcr  Vibrio cholerae O1 O395 Pathway vcr02024   Quorum sensing vcr03018   RNA degradation vcr05111   Biofilm formation - Vibrio cholerae Brite KEGG Orthology (KO) [BR:vcr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     VC395_0390  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     VC395_0390    05111 Biofilm formation - Vibrio cholerae     VC395_0390  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:vcr03019]     VC395_0390    03036 Chromosome and associated proteins [BR:vcr03036]     VC395_0390 Messenger RNA biogenesis [BR:vcr03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      VC395_0390 Chromosome and associated proteins [BR:vcr03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     VC395_0390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  ACP08413 UniProt:  A5F3L7 LinkDB All DBs Position I:419583..419846 Genome browser AA seq 87 aa AA seqDB search MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAIS TVVPARPVSHHSGDRPASDRPAEKSEE NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctctacaagacccatttctgaatgcactacgtcgtgaacgtatc cctgtttctatctaccttgtgaacggcattaaactgcaaggtcagatcgaatcatttgat caatttgtgatcttgctgaagaacacagtaaaccaaatggtttacaagcatgcgatttct actgtggttcctgctcgtccagttagccaccacagcggcgaccgcccagcatcggatcgt ccagcagagaagtctgaagagtaa

DBGET integrated database retrieval system