Vibrio cholerae O1 O395: VC395_0544 Help Entry VC395_0544        CDS       T02099                                  Symbol ftsB Name (GenBank) Cell division protein ftsB   KO K05589   cell division protein FtsB Organism vcr  Vibrio cholerae O1 O395 Brite KEGG Orthology (KO) [BR:vcr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vcr03036]     VC395_0544 (ftsB) Chromosome and associated proteins [BR:vcr03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     VC395_0544 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC MENTAL Motif Other DBs NCBI-ProteinID:  ACP08563 UniProt:  A0A0H3ALM2 LinkDB All DBs Position I:581979..582269 Genome browser AA seq 96 aa AA seqDB search MVMRVFALTLSLLLVWLLYTLMWGKNGVMDFRAVQAEIEVQQQVNANLHLRNQEMFAEID DLRQGLDAIEERARNELGMVKDGETFYRIIGEESRQ NT seq 291 nt NT seq  +upstreamnt  +downstreamnt ttggttatgcgagtatttgctttgaccctaagcctgctattggtctggctgctttatacc ctgatgtggggcaaaaacggtgtgatggattttcgcgctgtacaagcggaaattgaagtg cagcagcaggtgaatgccaaccttcacctacgcaaccaagagatgtttgctgaaattgat gacctgcgccaagggctagatgcgattgaagagcgtgcccgtaacgaattgggtatggtc aaagatggagaaaccttctatcgcatcatcggtgaggagtcgcgccaatga

DBGET integrated database retrieval system