Vibrio crassostreae: IS519_06345 Help Entry IS519_06345       CDS       T08776                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vcra  Vibrio crassostreae Pathway vcra01100   Metabolic pathways vcra01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vcra00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IS519_06345    00074 Mycolic acid biosynthesis     IS519_06345   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IS519_06345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UPR30905 LinkDB All DBs Position 1:1423985..1424245 Genome browser AA seq 86 aa AA seqDB search METLHNELKQLIIDALNLEDMSIDEIETEAPLFGDGLGLDSIDALELGLAIKKKYNIVID ADDSNTRQHFASVENLANYISSQTNN NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtggaaacattacacaacgaactgaaacaactgatcatcgacgcattgaaccttgaagac atgagtattgatgagattgaaacggaagctccactatttggtgatggacttggattagac tctattgatgcgctagagcttggtcttgctatcaagaagaagtacaacatcgttatcgat gccgacgattcaaacactcgccagcactttgcatccgttgaaaacctagcaaattacatc tcatctcaaacgaacaactag

DBGET integrated database retrieval system