Vespa crabro (European hornet): 124422160 Help Entry 124422160         CDS       T09462                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism vcrb  Vespa crabro (European hornet) Pathway vcrb04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:vcrb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     124422160  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:vcrb04121]     124422160    03400 DNA repair and recombination proteins [BR:vcrb03400]     124422160 Ubiquitin system [BR:vcrb04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      124422160    Cul5 complex      124422160 DNA repair and recombination proteins [BR:vcrb03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      124422160 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Motif Other DBs NCBI-GeneID:  124422160 NCBI-ProteinID:  XP_046814178 EnsemblRapid:  ENSVCRG00010007062 LinkDB All DBs Position 2:complement(2362177..2363350) Genome browser AA seq 116 aa AA seqDB search MDVFLMIRRKNTTIFTDANDNTTVHELKKIIEGILKVPPANQQLFNKDNVVMSDSKYLSD YGLTSITAKAQCPALIGLAIRQENGHFEPLEMTPFSLPPDLPDVMKGCEPNGSESP NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggacgtatttttgatgatcaggcgaaaaaataccacgatttttacggatgcaaacgat aatacaacagttcacgagcttaaaaaaattattgaaggtattttgaaagtaccaccagca aatcaacaactatttaacaaagataatgttgttatgtctgattctaaatacctgtcagat tatggattgacatctataactgcaaaagcacaatgtcctgcattgataggattagctata cgtcaagaaaatggccatttcgaaccacttgaaatgaccccattttcactaccgcctgat cttccggacgttatgaagggttgtgaacctaatggttcagaatctccttga

DBGET integrated database retrieval system