Vespa crabro (European hornet): 124430785 Help Entry 124430785         CDS       T09462                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism vcrb  Vespa crabro (European hornet) Pathway vcrb04013   MAPK signaling pathway - fly vcrb04145   Phagosome vcrb04148   Efferocytosis vcrb04310   Wnt signaling pathway vcrb04620   Toll-like receptor signaling pathway vcrb05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:vcrb00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     124430785    04310 Wnt signaling pathway     124430785  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     124430785    04148 Efferocytosis     124430785  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     124430785  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     124430785  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vcrb04131]     124430785   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vcrb04147]     124430785    04031 GTP-binding proteins [BR:vcrb04031]     124430785 Membrane trafficking [BR:vcrb04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     124430785  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     124430785   Macropinocytosis    Ras GTPases     124430785  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     124430785 Exosome [BR:vcrb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124430785   Exosomal proteins of other body fluids (saliva and urine)    124430785   Exosomal proteins of colorectal cancer cells    124430785   Exosomal proteins of bladder cancer cells    124430785 GTP-binding proteins [BR:vcrb04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     124430785 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  124430785 NCBI-ProteinID:  XP_046833773 LinkDB All DBs Position 19:complement(545488..549319) Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQVKPKRRCFLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggctatcaagtgcgtggttgtcggtgacggagctgtgggtaaaacgtgcctcttg ataagttataccaccaatgcattcccgggagaatatatcccaacggtatttgacaactat tctgcaaacgtgatggtggatggaaagcccattaacctaggtctatgggatactgctggt caggaagattatgacagattaagaccattatcctatccacagacagatgtatttttgatt tgtttctcgttggtaaatcctgcaagttttgagaatgttcgtgctaaatggtatccagag gtacgtcatcactgtcctgccactccaattattttggtaggcactaaattggatctacgt gaggacaaagaaactatcgagcgtcttaaagataagaaattggcacctattacttatcct cagggtttggcaatggcgaaagagataggcgctgttaaatatttagagtgttctgcttta acgcagaagggtttgaagactgtttttgatgaagcaattcgtgctgttttatgtcctgtt cttcaggttaaaccaaaacgcagatgtttccttctataa

DBGET integrated database retrieval system