Vibrio cholerae O1 El Tor MS6: MS6_0116 Help Entry MS6_0116          CDS       T03666                                  Name (GenBank) acyl carrier protein, putative   KO K02078   acyl carrier protein Organism vcs  Vibrio cholerae O1 El Tor MS6 Pathway vcs01100   Metabolic pathways vcs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vcs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MS6_0116    00074 Mycolic acid biosynthesis     MS6_0116   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MS6_0116 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7215 DUF7080 Motif Other DBs NCBI-ProteinID:  BAP01771 LinkDB All DBs Position 1:133232..133465 Genome browser AA seq 77 aa AA seqDB search MSISEEKIINLIAGILEVEIGIINKELAVGDIPEWDSLAHMRIIAALESDLGVVLDIEQV LEIEDVEDIIDAVINNE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtctatctctgaagaaaaaattatcaatcttattgcaggaattcttgaagtagaaatt ggtattattaataaagaacttgccgttggtgatatccctgaatgggactcgttagctcac atgagaataattgcggctcttgaatcggatttgggagtagttttggatatcgaacaagtt cttgaaatagaagatgttgaagatattatcgatgctgtaattaataacgagtaa

DBGET integrated database retrieval system