Venatoribacter cucullus: GJQ55_06215 Help Entry GJQ55_06215       CDS       T07641                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism vcw  Venatoribacter cucullus Brite KEGG Orthology (KO) [BR:vcw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:vcw03032]     GJQ55_06215    03036 Chromosome and associated proteins [BR:vcw03036]     GJQ55_06215    03400 DNA repair and recombination proteins [BR:vcw03400]     GJQ55_06215 DNA replication proteins [BR:vcw03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     GJQ55_06215 Chromosome and associated proteins [BR:vcw03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     GJQ55_06215 DNA repair and recombination proteins [BR:vcw03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       GJQ55_06215 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 HU-CCDC81_bac_2 Barstar Motif Other DBs NCBI-ProteinID:  QQD24093 UniProt:  A0A9E8JPG5 LinkDB All DBs Position 1327623..1327895 Genome browser AA seq 90 aa AA seqDB search MNKTELIDAIAAQADIPKAAAGRALDAMIDSIGTALKSGDQVALVGFGTFLVKERAARTG RNPQTGAPIEIKAAKVPGFKAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaaaactgaattgattgatgccattgccgctcaggcggacattcctaaagcggct gctggtcgtgcactggacgccatgatcgacagcattggcactgcactgaaaagcggtgat caggttgctctggttggtttcggtactttcctggtgaaagaacgtgctgcccgtaccggc cgtaacccgcagactggcgctccgatcgaaatcaaagccgccaaggttcctggtttcaaa gctggcaaagcgctgaaagacgctgtcaactaa

DBGET integrated database retrieval system