Venatoribacter cucullus: GJQ55_06630 Help Entry GJQ55_06630       CDS       T07641                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vcw  Venatoribacter cucullus Pathway vcw01100   Metabolic pathways vcw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vcw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GJQ55_06630 (acpP)    00074 Mycolic acid biosynthesis     GJQ55_06630 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GJQ55_06630 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 AMPK_alpha_AID Motif Other DBs NCBI-ProteinID:  QQD24169 UniProt:  A0A9E8JM44 LinkDB All DBs Position 1410928..1411161 Genome browser AA seq 77 aa AA seqDB search MSNIEERVKKIVCEQLGVKEEDVKASSSFVDDLGADSLDTVELVMALEEEFETEIPDEAA EKLTTVQEAIDYIIANL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaatatcgaagaacgcgtaaaaaaaatcgtctgtgaacaactgggcgtaaaagaa gaagacgttaaagcttcatcttctttcgtagacgatctgggcgctgattccctggatact gtagagctggtaatggctctggaagaagaattcgaaaccgaaattccggacgaagcggca gaaaaactgaccaccgttcaggaagctatcgattacatcatcgcaaatctctga

DBGET integrated database retrieval system