Venatoribacter cucullus: GJQ55_10475 Help Entry GJQ55_10475       CDS       T07641                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism vcw  Venatoribacter cucullus Brite KEGG Orthology (KO) [BR:vcw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vcw03036]     GJQ55_10475 (ftsL) Chromosome and associated proteins [BR:vcw03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     GJQ55_10475 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  QQD24867 UniProt:  A0A9E8FN68 LinkDB All DBs Position complement(2223014..2223259) Genome browser AA seq 81 aa AA seqDB search MPLLMWLLVLAAALAQVAVSHQHRELLQQWQQQDARRLSLQQEYTRLLLERSTLSAHGRL DQLARKQLNMTDPQQVQVLRK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgccgctgctgatgtggttgctggtgttggcagcggcgctggcgcaggtggcggtgagc catcagcaccgcgaattgctgcagcaatggcaacaacaggatgcgcggcgtttgtcgttg cagcaggagtacacaaggctgttgctggaacgcagcacgctgagtgcccatggccggctg gatcagctggcccgcaaacaattaaacatgaccgacccacaacaagtgcaggtgttgcgt aaatga

DBGET integrated database retrieval system