Verticillium dahliae: VDAG_01000 Help Entry VDAG_01000        CDS       T03450                                  Name (RefSeq) dynein light chain   KO K10418   dynein light chain LC8-type Organism vda  Verticillium dahliae Pathway vda04814   Motor proteins Brite KEGG Orthology (KO) [BR:vda00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     VDAG_01000  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:vda03037]     VDAG_01000    04812 Cytoskeleton proteins [BR:vda04812]     VDAG_01000 Cilium and associated proteins [BR:vda03037]  Motile cilia and associated proteins   Dynein arm    VDAG_01000 Cytoskeleton proteins [BR:vda04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      VDAG_01000 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  20702463 NCBI-ProteinID:  XP_009648181 UniProt:  G2WT77 LinkDB All DBs Position 1 AA seq 100 aa AA seqDB search MADKGSAEAPREAKLEAQIKSADMTDDMQQEVIEVAQEAMGRFTIEKDIAQQIKKTFDER KGPTWHCIVGRNFGSFVTHETKHFIYFYLGHCAILLFKTQ NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggccgacaagggaagtgctgaggctccacgggaggcgaagcttgaagcccagatcaaa tccgcagacatgaccgacgatatgcaacaggaggtcatcgaagttgctcaggaagcgatg ggtcgatttacgattgagaaggacattgcccaacagatcaagaagacgttcgatgagcgc aagggtccgacgtggcactgcattgtcggccgcaactttggaagctttgtgacgcacgag acgaagcatttcatctacttctaccttggccactgcgccatcctcctcttcaagacccaa taa

DBGET integrated database retrieval system