Verticillium dahliae: VDAG_01225 Help Entry VDAG_01225        CDS       T03450                                  Name (RefSeq) Microtubule associated protein   KO K08341   GABA(A) receptor-associated protein Organism vda  Verticillium dahliae Pathway vda04136   Autophagy - other vda04138   Autophagy - yeast vda04139   Mitophagy - yeast Brite KEGG Orthology (KO) [BR:vda00001]  09140 Cellular Processes   09141 Transport and catabolism    04138 Autophagy - yeast     VDAG_01225    04136 Autophagy - other     VDAG_01225    04139 Mitophagy - yeast     VDAG_01225  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vda04131]     VDAG_01225    04121 Ubiquitin system [BR:vda04121]     VDAG_01225    03029 Mitochondrial biogenesis [BR:vda03029]     VDAG_01225 Membrane trafficking [BR:vda04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     VDAG_01225 Ubiquitin system [BR:vda04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    VDAG_01225 Mitochondrial biogenesis [BR:vda03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     VDAG_01225 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ATG8 APG12 Hanta_Gn-B Motif Other DBs NCBI-GeneID:  20702688 NCBI-ProteinID:  XP_009648406 UniProt:  G2WTV2 LinkDB All DBs Position 1 AA seq 121 aa AA seqDB search MRSKFKDEHPFEKRKAEAERIRQKYSDRIPVICEKVEKSDIATIDKKKYLVPADLTVGQF VYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGDCET A NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgcgatccaagttcaaggacgagcaccccttcgagaagcgtaaggctgaggccgagcgc attcgtcagaagtactcggaccgtattcctgtcatctgcgagaaggtggaaaagtccgac atcgccaccatcgataagaagaagtatctggtgcccgcggacctgaccgtcggtcagttc gtctacgtcatccggaagcgtatcaagctctccccggagaaggccattttcatcttcgtc gatgaggtcctgccacccacggctgccttgatgagcagcatctacgaggagcacaaggac gaggacggcttcctctacattacctactctggcgagaacaccttcggcgactgcgagact gcttga

DBGET integrated database retrieval system