Verticillium dahliae: VDAG_02474 Help Entry VDAG_02474        CDS       T03450                                  Name (RefSeq) cell division control protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism vda  Verticillium dahliae Pathway vda04145   Phagosome vda04148   Efferocytosis vda04620   Toll-like receptor signaling pathway vda05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:vda00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     VDAG_02474    04148 Efferocytosis     VDAG_02474  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     VDAG_02474  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     VDAG_02474  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vda04131]     VDAG_02474   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vda04147]     VDAG_02474    04031 GTP-binding proteins [BR:vda04031]     VDAG_02474 Membrane trafficking [BR:vda04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     VDAG_02474  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     VDAG_02474   Macropinocytosis    Ras GTPases     VDAG_02474  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     VDAG_02474 Exosome [BR:vda04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    VDAG_02474   Exosomal proteins of other body fluids (saliva and urine)    VDAG_02474   Exosomal proteins of colorectal cancer cells    VDAG_02474   Exosomal proteins of bladder cancer cells    VDAG_02474 GTP-binding proteins [BR:vda04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     VDAG_02474 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  20703937 NCBI-ProteinID:  XP_009651422 UniProt:  G2WXZ2 LinkDB All DBs Position 3 AA seq 200 aa AA seqDB search MAQPGVQSLKCVVTGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSASVMVDGKPISLGL WDTAGQEDYDRLRPLSYPQTDVFLICFSIVSPPSFDNVKAKWYPEIDHHAPNIPIILVGT KLDLREDPGTLESLRQKRMEPVSYDQALVCAKEIRAHKYLECSALTQRNLKSVFDEAIRY FNASRLWHCDNLLTRIPVPS NT seq 603 nt NT seq  +upstreamnt  +downstreamnt atggctcaaccaggtgttcagtctttgaagtgcgtcgtgaccggcgacggtgccgtcgga aagacgtgcttgctcatctcctacacaacgaatgctttccctggcgaatacattcctaca gtctttgacaactactctgctagtgttatggtggatggcaagccaatcagcttgggactg tgggatactgccggtcaagaggattatgacaggctgcgacctctctcttacccccagact gacgtctttctcatctgcttctccatcgtcagcccgccgtcattcgacaacgtgaaggct aagtggtaccccgagattgaccaccacgcaccaaacattcccattatcctcgtcggcact aagctcgatcttcgggaggatcccggcaccctcgagtcgctgcgccagaagcgcatggag ccggtctcctacgaccaggccctggtgtgtgctaaggagatcagggcgcacaagtacctc gagtgctctgcgctcacgcagaggaacctcaagagcgtctttgacgaggctatccggtat ttcaacgcgtcacgactctggcattgcgacaacctgctaactcggatcccagtgccgtct tga

DBGET integrated database retrieval system