Verticillium dahliae: VDAG_06919 Help Entry VDAG_06919        CDS       T03450                                  Name (RefSeq) GTP-binding protein rho1   KO K04513   Ras homolog gene family, member A Organism vda  Verticillium dahliae Pathway vda04011   MAPK signaling pathway - yeast vda04081   Hormone signaling vda04144   Endocytosis vda05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:vda00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     VDAG_06919   09133 Signaling molecules and interaction    04081 Hormone signaling     VDAG_06919  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     VDAG_06919  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     VDAG_06919  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vda04131]     VDAG_06919   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vda04147]     VDAG_06919    04031 GTP-binding proteins [BR:vda04031]     VDAG_06919 Membrane trafficking [BR:vda04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     VDAG_06919 Exosome [BR:vda04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    VDAG_06919   Exosomal proteins of other body fluids (saliva and urine)    VDAG_06919   Exosomal proteins of colorectal cancer cells    VDAG_06919   Exosomal proteins of bladder cancer cells    VDAG_06919 GTP-binding proteins [BR:vda04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     VDAG_06919 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB DUF6990 baeRF_family3 Motif Other DBs NCBI-GeneID:  20708382 NCBI-ProteinID:  XP_009654119 UniProt:  G2XA16 LinkDB All DBs Position 5 AA seq 195 aa AA seqDB search MAEIRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVADVEVDGKHVELALWDT AGQEDYDRLRPLSYPDSHVILICFSIDSPDSLDNVQEKWISEVLHFCQGLPIILVGCKKD LRYDNKTIEELRKTSQKPVSPEEGEEVRKKIGAYKYLECSAKTNEGVREVFEHATRAALL SRSRGGSKKHKCNLL NT seq 588 nt NT seq  +upstreamnt  +downstreamnt atggccgaaatccggcgaaagctcgtcatcgtcggcgacggtgcctgtggtaaaacctgc ttgttgatcgtcttctccaagggcactttccccgaggtttacgtccccaccgtcttcgag aactatgtcgccgatgtcgaggtcgatggcaagcacgtcgagctagctctttgggatacc gctggccaggaggattacgaccgtcttcgccctctgtcctaccccgactcccacgtcatc ctcatttgcttctccatcgactctcccgactcgctcgacaacgtccaggagaagtggatc tccgaggttctgcacttctgccagggcctgcccatcatccttgtcggctgcaagaaggat ctccgctacgacaacaagacgattgaggagctccgcaagacgagccagaagcccgtgtcg cctgaggagggtgaggaggttcgcaagaagatcggcgcctacaagtacctcgagtgctct gccaagacgaacgagggagtccgtgaggtctttgagcacgccactcgtgccgcccttctg tcgcgcagccgaggcggcagcaagaagcacaagtgcaacctgctctaa

DBGET integrated database retrieval system