Vibrio diabolicus: AL552_09650 Help Entry AL552_09650       CDS       T05332                                  Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism vdb  Vibrio diabolicus Brite KEGG Orthology (KO) [BR:vdb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vdb03036]     AL552_09650 Chromosome and associated proteins [BR:vdb03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     AL552_09650 SSDB OrthologParalogGFIT Motif Pfam:  ZapB PspA_IM30 Nuf2_DHR10-like Rab11-FIP3 SPC25_N YabA Dor1 CC_Bre1 YjcZ Alanine_zipper Syntaxin DUF7491 bHLH_IRO3 T4SS_LegC2C7 APG6_N Spc7 Dynamin-like_hel_bact SSNA1 ApoLp-III Ax_dynein_light Muted Tup_N THOC7 DUF7237 DUF2203 DUF6549 DUF4140 HAUS1 ERM_helical NPV_P10 CEP89 LEKR1 DUF3450 HAUS-augmin3 CEP135_N DGCcoil Mod_r Herpes_UL6 Map3k7cl MctB TMF_TATA_bd CC_Liprin_beta Leu_zip YdhS_M betaPIX_CC COG3_N CsiV Prefoldin DUF4164 Occludin_ELL COG6_N ATG14 CENPU DUF4337 YGR130C_N Sec10_N DUF948 DUF4407 5_nucleotid UPF0242 FapA Prefoldin_2 VspR_C Prominin DUF1664 YGR130C_C MCU AAA_13 DUF3810 OmpH K-box DUF6161 Motif Other DBs NCBI-ProteinID:  AVF94053 LinkDB All DBs Position 1:155049..155291 Genome browser AA seq 80 aa AA seqDB search MSFEVLEQLESKIQTAVDTITLLQMEVEELKEDKAKLAEEANELRSQREELEQKAQQAQQ EHAQWQERIRALLGKMDEVE NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtcttttgaagtactagaacaactagaatctaaaattcaaactgcagttgacacaatc actcttcttcagatggaagtcgaagagctgaaagaagataaagcaaaacttgcggaagaa gcgaacgagcttcgctctcaacgtgaagagctagagcaaaaagcacagcaagcacaacaa gagcacgcgcaatggcaagagcgcattcgtgcactacttggcaaaatggacgaagtggaa taa

DBGET integrated database retrieval system