Varroa destructor (honeybee mite): 111243784 Help Entry 111243784         CDS       T07383                                  Name (RefSeq) cystatin-B-like   KO K13907   cystatin-A/B Organism vde  Varroa destructor (honeybee mite) Brite KEGG Orthology (KO) [BR:vde00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:vde01002]     111243784   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vde04147]     111243784 Peptidases and inhibitors [BR:vde01002]  Peptidase inhibitors   Family I25: cystatin family    111243784 Exosome [BR:vde04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    111243784 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin Motif Other DBs NCBI-GeneID:  111243784 NCBI-ProteinID:  XP_022645599 UniProt:  A0A7M7J1P8 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPMCGSTGSVKPVDDECRDVLGRVREGCEEKAGKKFEYFEPIHYKTQLVNGINFFIKVKI ADNDYLHVRAHKSFQDEVTLWGIQQSKILEEEVHYFD NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgatgtgtgggtctactggatcagtgaagcctgtagatgacgagtgtcgagatgta cttggaagagttcgtgaaggctgtgaggagaaggctggcaaaaaatttgaatattttgag ccgatccattataagacccagttagtgaatgggattaactttttcataaaggtgaagatt gctgataatgactatctccatgttcgggcgcacaaatcgttccaggatgaggtgactcta tggggtattcagcaaagcaaaattttagaggaagaggttcattactttgactaa

DBGET integrated database retrieval system