Varroa destructor (honeybee mite): 111247044 Help Entry 111247044         CDS       T07383                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism vde  Varroa destructor (honeybee mite) Pathway vde04145   Phagosome vde04148   Efferocytosis vde04310   Wnt signaling pathway vde04620   Toll-like receptor signaling pathway vde05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:vde00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     111247044  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     111247044    04148 Efferocytosis     111247044  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111247044  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     111247044  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vde04131]     111247044   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vde04147]     111247044    04031 GTP-binding proteins [BR:vde04031]     111247044 Membrane trafficking [BR:vde04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     111247044  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     111247044   Macropinocytosis    Ras GTPases     111247044  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     111247044 Exosome [BR:vde04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111247044   Exosomal proteins of other body fluids (saliva and urine)    111247044   Exosomal proteins of colorectal cancer cells    111247044   Exosomal proteins of bladder cancer cells    111247044 GTP-binding proteins [BR:vde04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     111247044 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  111247044 NCBI-ProteinID:  XP_022653309 UniProt:  A0A7M7JKE4 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MMQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTA GQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVSHHGPNTPIILVGTKLDL RDDKDTLEKLRDRKLAPITYPQGLGMAKEITAVKYLECSALTQKGLKNVFDEAIRAVLCP PYKPTKKRKCVIL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgatgcaggcgataaagtgtgtcgttgtcggcgacggagccgttggtaagacgtgtctt ctgatttcctacaccacgaatgccttcccaggcgaatacatacctacggtattcgacaac tattctgcgaacgtgatggttgacgggaagcccattaatcttggactctgggatactgct ggtcaggaagactacgatcgactacgccccctatcatacccgcagacagatgtgttcctt atctgcttctcactagttaatcccgcatcgttcgaaaacgtccgtgcaaaatggtaccca gaagtcagccatcatggtcctaatacaccgatcattcttgtgggaaccaagcttgatctt cgagacgacaaagacacattggaaaagttgcgggaccgtaaactcgctccgatcacgtac ccgcagggtctcggaatggccaaagagatcacagctgtcaagtatctcgagtgttctgct ctgactcaaaagggcctgaagaacgtgttcgatgaagctatccgagccgtactctgcccg ccttataagccgacgaagaaaaggaagtgcgtgattctctag

DBGET integrated database retrieval system