Varroa destructor (honeybee mite): 111249138 Help Entry 111249138         CDS       T07383                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism vde  Varroa destructor (honeybee mite) Pathway vde04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:vde00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     111249138  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:vde04121]     111249138    03400 DNA repair and recombination proteins [BR:vde03400]     111249138 Ubiquitin system [BR:vde04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      111249138    Cul5 complex      111249138 DNA repair and recombination proteins [BR:vde03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      111249138 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD GABP-alpha Motif Other DBs NCBI-GeneID:  111249138 NCBI-ProteinID:  XP_022658321 UniProt:  A0A7M7JWU0 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MDVFVMVRRKQTTLFLDAKETTPVLDLKKMIHGILKIKPEEQRLYHNDIQMDDNKTLTDC GLNANSAKAQAPATIGLAVSDETLEITPLSSPPELPDVMKSQDSAVDPACA NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggatgtttttgtcatggttcgccgtaagcagaccaccctcttccttgatgctaaggaa acgacgcccgtgctcgatctcaagaaaatgatccatggcatccttaaaatcaaacctgag gaacaacgcttgtaccacaacgatatccagatggacgataataagacgttgaccgactgc ggtctcaacgcgaattcggccaaagcgcaagcgcccgctacaatcggactggccgtaagc gatgagaccctagagatcactccgttatcgtcgccacccgagctgcctgatgtcatgaag agccaggattcggcggtggacccggcctgcgcctaa

DBGET integrated database retrieval system