Varroa destructor (honeybee mite): 111249163 Help Entry 111249163         CDS       T07383                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism vde  Varroa destructor (honeybee mite) Pathway vde04137   Mitophagy - animal vde04140   Autophagy - animal vde04144   Endocytosis vde04145   Phagosome vde04148   Efferocytosis Brite KEGG Orthology (KO) [BR:vde00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     111249163    04145 Phagosome     111249163    04140 Autophagy - animal     111249163    04137 Mitophagy - animal     111249163    04148 Efferocytosis     111249163  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vde04131]     111249163   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vde04147]     111249163    04031 GTP-binding proteins [BR:vde04031]     111249163 Membrane trafficking [BR:vde04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     111249163 Exosome [BR:vde04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111249163   Exosomal proteins of other body fluids (saliva and urine)    111249163   Exosomal proteins of colorectal cancer cells    111249163   Exosomal proteins of bladder cancer cells    111249163 GTP-binding proteins [BR:vde04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     111249163 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase ATP_bind_1 cobW AAA_22 nSTAND3 Septin AAA_16 NTPase_1 AAA_7 PduV-EutP AAA_24 SRPRB ABC_tran ATPase_2 NB-ARC NACHT MCM AAA_14 ATP-synt_ab AAA_5 Motif Other DBs NCBI-GeneID:  111249163 NCBI-ProteinID:  XP_022658399 UniProt:  A0A7M7M8V7 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MSSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSSQYKATIGADFLTKEVMVDNKLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTSPTTFKSLESWRDEFLIQASPRDPENFPF VVIGNKIDLENRSIMQKRAQSWCQSKNSIPYFETSAKEALHVDEAFATVARNALAQETEV ELYNEFPDQIKLSPGLSGGVRQDNCGC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcccgaaagaaggtgcttcttaaagttatcatcctcggtgactctggtgtcggc aagacgtctcttatgaaccagtacgtgaacaagaaattctcgtcacaatataaagctacc atcggagcagatttcctaacaaaggaagttatggtcgacaacaaacttgtcaccatgcag atttgggatacggcaggacaggaacgattccagtctctcggagtggcattttatcgaggt gcagattgctgcgtgctcgtctatgatgtgacatctccaacgaccttcaaaagtcttgaa agctggcgcgatgagttccttattcaagcttcacccagagaccccgagaatttccccttc gtcgtcattggaaacaagatcgaccttgagaaccggtctatcatgcagaagcgcgcacag tcgtggtgtcaatcaaagaatagcattccctattttgaaacctcggccaaggaagcactt catgtcgacgaagcgttcgcaacggtggcacggaatgccctcgctcaggaaaccgaggtc gaactgtacaatgaattccctgatcaaattaaactgtcgcccgggctgtctggcggagtg cgccaggacaactgtggatgctag

DBGET integrated database retrieval system