Varroa destructor (honeybee mite): 111250000 Help Entry 111250000         CDS       T07383                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism vde  Varroa destructor (honeybee mite) Pathway vde04068   FoxO signaling pathway vde04136   Autophagy - other vde04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:vde00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     111250000  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     111250000    04136 Autophagy - other     111250000  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vde04131]     111250000    04121 Ubiquitin system [BR:vde04121]     111250000    03029 Mitochondrial biogenesis [BR:vde03029]     111250000 Membrane trafficking [BR:vde04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     111250000 Ubiquitin system [BR:vde04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    111250000 Mitochondrial biogenesis [BR:vde03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     111250000 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  111250000 NCBI-ProteinID:  XP_022660288 UniProt:  A0A7M7K291 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search MEDAIVPRQEVPEKVDVLLKATGDAPILRRSKWNVRSELTVAQLMIRVKQILQLNPNESL FFYVNQAFAPPLDEKLSTLFEVYSTNGKLALHYAKTEAWG NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggaggatgcgattgtgccgaggcaggaggtaccagaaaaagttgacgtcctcttgaaa gcgactggtgatgcgccaattctcagaaggtccaaatggaacgttcgatctgagctgaca gttgcccaattgatgatacgcgtaaaacaaattttacaattaaatccaaatgagtcgctt ttcttttacgtcaatcaagcctttgctccacctctcgacgaaaagctatccactcttttt gaagtgtattctacaaacggaaagctggcacttcactatgctaagaccgaggcgtggggt tga

DBGET integrated database retrieval system