KEGG   Verminephrobacter eiseniae: Veis_3151
Entry
Veis_3151         CDS       T00460                                 
Name
(GenBank) nitrogen metabolism transcriptional regulator, NtrC, Fis family
  KO
K07712  two-component system, NtrC family, nitrogen regulation response regulator GlnG
Organism
vei  Verminephrobacter eiseniae
Pathway
vei02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vei00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Veis_3151
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vei02022]
    Veis_3151
Two-component system [BR:vei02022]
 NtrC family
  GlnL-GlnG (nitrogen regulation)
   Veis_3151
SSDB
Motif
Pfam: Sigma54_activat Sigma54_activ_2 Response_reg HTH_8 AAA_5 AAA_16 AAA_2 AAA nSTAND3 APS_kinase AAA_18 Peptidase_S41
Other DBs
NCBI-ProteinID: ABM58882
UniProt: A1WMM5
LinkDB
Position
complement(3506480..3508099)
AA seq 539 aa
MKPIWIVDDDPSIRFVLEKALARENLPTRSFTQPREVLDALTDLDTGDCGRQGPQVLVSD
IRMPGGSGLLLLEKVRELQPGLPIIIMTAYSDLDSAVSAFQRGAFEYLPKPFDLPKAVAL
IRRAVEESQREEVTEERQGATPEILGQAPAMQDLFRAIGRLSQSQVTVLITGESGSGKEL
VARALHKHSPCADGPFVAINTAAIPKDLLESELFGHERGAFTGAQTQRRGRFEQAEGGTL
FLDEIGDMPFDLQTRLLRVLSDGQFYRVGGHAALKAHVRVIAATHQDLEKRVKAGSFRED
LFHRLNVIRLRLPALRERREDVPMLTRHFLQQSARQLGVEPKRIADSALARLEQFAFPGN
VRQLENICHWLTVMAPAQVISLQDLPPEVLEAPAHQAAHHPPARMEQIGHASEPVAVPAT
AICPPPAEPQEALPPPVPATMAGNAPAMPAFAATSPQRENDGHRASWEEILEIEAQKLLA
GGQSQLWDALTRRFESCLIRTALHTTHGRRMEAAQRLGIGRNTITRKIQELGLDSPDEA
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgaagccgatctggatagtagatgacgacccctcgatccgcttcgtccttgaaaaggcg
ctggcccgcgaaaacctgcccacgcgcagcttcacacagccgcgcgaagtgctcgacgcg
ctgaccgacctcgacaccggcgactgcggccggcaaggcccgcaggtcctggtgagcgac
atccgcatgcccggcggctcgggcctgctgctgctggaaaaagtgcgcgagctgcaaccc
ggtttgccgatcatcatcatgaccgcgtactccgacctcgacagcgccgtttcggccttt
cagcgcggcgcattcgagtacctgcccaagcccttcgacctgcccaaggccgtcgccctg
atccgccgcgccgtggaagaaagccagcgcgaagaagtcaccgaagagcggcaaggcgca
acgcccgaaatactgggccaggcgccggcgatgcaggacctgttccgggccatcggccgg
ctgagccaaagccaggtcaccgtgctgatcaccggcgaatccggctcgggcaaagaactg
gtggcgcgcgcgctgcacaagcactcgccctgcgccgacggccccttcgtggccatcaac
accgcagccatccccaaagacctgctcgagtccgaactgttcggccacgaacgcggcgcc
ttcaccggcgcgcaaacccagcggcgcggccgcttcgagcaggccgagggcggcaccctg
ttcctggacgaaatcggcgacatgccgttcgacctgcaaacgcgcctgttgcgcgtacta
tcggacggccagttctaccgcgtgggcggccatgcggcgctcaaggcgcatgtgcgggtg
atcgccgccacccaccaagacctggaaaagcgcgtcaaggccggcagcttccgcgaagac
ctgttccaccgcctgaacgtcatccgcctgcgcctgcccgcgctgcgcgagcggcgtgaa
gacgtgcccatgctcacgcgccacttcctgcaacaaagcgccagacagttgggcgtggaa
cccaaacgcatcgccgactcggcattggcgcggctggagcaattcgccttcccaggcaat
gtgcgccagttggagaacatctgccactggctcaccgtcatggcgccggcccaggtgatc
tcgctgcaagacctgcccccggaagtgctggaggcgcctgcgcaccaagccgcgcaccac
ccccccgcgcggatggagcagatcggccacgccagcgagccggtggcggtgccggcaact
gccatctgccccccccctgccgaaccgcaggaagcactgcccccgcctgtgcccgccact
atggcgggcaacgcgccggcaatgccggcctttgccgccaccagcccccagcgggagaac
gacggccatcgggccagttgggaagaaatactggaaatcgaggcacaaaagctgctcgcc
ggcggccaatcgcagctgtgggatgcgctcacgcggcgcttcgagtcctgcctgatccgc
accgcgctgcacaccacccacggccgccgcatggaagccgcgcagcgtctgggcatagga
cgcaacaccatcacgcgcaaaatccaggaactggggctggactccccggatgaggcatga

DBGET integrated database retrieval system