Verminephrobacter eiseniae: Veis_5012
Help
Entry
Veis_5012 CDS
T00460
Name
(GenBank) protein translocase subunit yidC
KO
K03217
YidC/Oxa1 family membrane protein insertase
Organism
vei
Verminephrobacter eiseniae
Pathway
vei02024
Quorum sensing
vei03060
Protein export
vei03070
Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:
vei00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03060 Protein export
Veis_5012
09130 Environmental Information Processing
09131 Membrane transport
03070 Bacterial secretion system
Veis_5012
09140 Cellular Processes
09145 Cellular community - prokaryotes
02024 Quorum sensing
Veis_5012
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:
vei03029
]
Veis_5012
09183 Protein families: signaling and cellular processes
02044 Secretion system [BR:
vei02044
]
Veis_5012
Mitochondrial biogenesis [BR:
vei03029
]
Mitochondrial quality control factors
Mitochondrial respiratory chain complex assembly factors
Complex-IV assembly factors
Veis_5012
Secretion system [BR:
vei02044
]
Sec (secretion) system
Prokaryotic Sec-SRP core components
Veis_5012
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
YidC_periplas
60KD_IMP
DUF2427
Motif
Other DBs
NCBI-ProteinID:
ABM60698
UniProt:
A1WSU1
LinkDB
All DBs
Position
complement(5564144..5565847)
Genome browser
AA seq
567 aa
AA seq
DB search
MNDIRRSVLWVIFGFSMILLWDKWQVHNGNRALFFPAPAPTAPAASAGARPASADAAHVP
APAAGASPDAVPGQPAVSGQPAAVPVARERVQVQTDLYRLTFDSQGGSLTHAELLEHADM
ADKTRRFLLLDESAQRVYVAQTGLIGGSFPTHKTPMTALPGPRELAEGANELAIRFESPS
QGGLKLVKTWTLRRGSYAIAVRHEVVNTGSATVSPQLYLQLVRDGNKPPGESSFYSTFTG
PAVYTDAKKYQKIEFKDIENDKVDIPKEAPDGYVAMVQHYFATAWLLADGVQRQPFTRKV
DTNLYSVGMLTPLGSIAPGASRTLDARLFAGPQVETMLETLSPGLELVKDYGWLTILAKP
LYWLLEQLHKLLRNWGWSIVGLVLLLKIAFYWLNAKAYASMAKMKAINPKIMEMRERLKD
KPQQMQQEMMRIYREEKVNPMGGCFPIVIQIPVFIALYWVLLSSVEMRNAPWIGWIHDLS
TPDPLFILPLLMTASSLLQTALNPAPPDPMQAKMMWFMPLIFSVMFFFFPAGLVLYWLTN
NILSIAQQWIINTRMGVPPQFNLPKFR
NT seq
1704 nt
NT seq
+upstream
nt +downstream
nt
atgaacgacattcgccgctccgtcttgtgggtgatttttggcttttccatgattttgttg
tgggacaagtggcaagtgcataacggcaacagggccctgtttttccccgcccctgcgccg
actgcgcctgccgccagcgcaggcgccaggccggccagcgcagatgcggcccatgtcccg
gcgcctgccgccggcgcatccccggacgccgtgcctggtcaacccgcagtgtccgggcag
cccgccgcagtccctgtcgcgcgcgaacgggtgcaggtccagaccgacctgtaccgcctg
acttttgacagccaaggcggctcgctgacccatgccgaactgctcgaacatgccgacatg
gccgacaagacccggcgcttcctgctgctcgacgaaagcgcgcagcgcgtctatgtggcg
cagacggggctgatcggcggcagctttcccacgcacaagacgccgatgacggcgctgccc
ggcccgcgcgaactggccgagggcgcgaacgagctggccatccgcttcgagtcgccgagc
cagggcggcctgaagctggtcaagacctggaccctccggcgcggcagctatgcgattgcc
gtccggcatgaggtggtcaacaccggcagcgctaccgtgtcgccacagttgtatctgcaa
ctggtgcgcgacggcaacaagccgcccggagagtcctcgttttattccaccttcaccggc
cctgcggtctacaccgacgccaagaagtaccagaagatcgagttcaaggacatagaaaac
gacaaggtcgatatccccaaggaggcgcccgacggctatgtcgcgatggtgcagcattac
tttgccacggcctggctgctggccgatggggtgcagcgccaaccgttcacccgcaaggtc
gacaccaacctgtactcggtgggcatgctcacgccgctgggcagcatcgcgcccggtgcc
agccggacgctcgacgcccgcctgttcgccggcccgcaggtcgaaaccatgctggagacc
ctgtcccccgggctggaactggtcaaggactacggctggctgaccatcctggccaagccg
ctgtactggctgctcgaacagttgcacaagctgctgcgcaactggggctggtccatcgtc
ggtctggtgttgctgctcaagatcgcgttctattggctcaatgccaaagcctacgccagc
atggccaagatgaaggccatcaatcccaagatcatggagatgcgcgagcgcctgaaggac
aagccgcaacagatgcagcaggagatgatgcgcatctaccgcgaggaaaaggtcaacccg
atggggggctgctttccgatcgtgatccagattccggtgttcatcgcgctgtactgggtg
ctgctgtccagcgtggagatgcgcaacgcgccgtggatcggctggatccatgatctgtcc
acacccgacccgctcttcatcctgccgctgttgatgacggccagttcactgttgcagacg
gcgctgaacccggcgccgcccgatccgatgcaggccaagatgatgtggttcatgccgctg
atcttcagcgtgatgtttttcttcttcccggccggcctggtgctgtactggctgaccaac
aacatcctgtcgattgcgcagcagtggatcatcaacacccgcatgggcgtgccgccgcag
ttcaatctgcccaagttccggtga
DBGET
integrated database retrieval system