Vollenhovia emeryi: 105560560 Help Entry 105560560         CDS       T06016                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism vem  Vollenhovia emeryi Pathway vem04013   MAPK signaling pathway - fly vem04145   Phagosome vem04148   Efferocytosis vem04310   Wnt signaling pathway vem04620   Toll-like receptor signaling pathway vem05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:vem00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     105560560    04310 Wnt signaling pathway     105560560  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     105560560    04148 Efferocytosis     105560560  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105560560  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     105560560  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vem04131]     105560560   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vem04147]     105560560    04031 GTP-binding proteins [BR:vem04031]     105560560 Membrane trafficking [BR:vem04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     105560560  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     105560560   Macropinocytosis    Ras GTPases     105560560  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     105560560 Exosome [BR:vem04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105560560   Exosomal proteins of other body fluids (saliva and urine)    105560560   Exosomal proteins of colorectal cancer cells    105560560   Exosomal proteins of bladder cancer cells    105560560 GTP-binding proteins [BR:vem04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     105560560 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  105560560 NCBI-ProteinID:  XP_011865161 LinkDB All DBs Position Unknown AA seq 186 aa AA seqDB search RLCFPSAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAGQEDYDR LRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLREDKETI ERLKDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPVLQVKPK RRCFLL NT seq 561 nt NT seq  +upstreamnt  +downstreamnt cgtctctgtttccccagcgcggtgggtaaaacgtgcttgttgataagctacaccaccaac gcatttcccggggagtacattccaacggtgttcgacaattactcggcgaatgtgatggta gacgggaagccgatcaatctcggcctgtgggacaccgcgggacaggaggattatgacaga ctacggccgttgtcctatccgcaaaccgacgtctttctgatctgcttctcgctggtgaac ccggcgagcttcgagaacgtgcgcgccaagtggtatccggaagtgcgccaccactgtccg gccactccgattatcctggtcggcactaagctggatctgcgcgaggacaaggagaccatc gagcgtttgaaagacaagaagctggcccccattacttaccctcagggcttggcaatggca aaagagatcggcgctgtgaaatatttggagtgctccgccctgacgcagaaaggcttgaag actgtgttcgacgaggcgatacgcgccgtgctgtgccccgttctacaagtgaagccaaag cgcagatgtttccttctataa

DBGET integrated database retrieval system