Vollenhovia emeryi: 105564246
Help
Entry
105564246 CDS
T06016
Name
(RefSeq) DNA repair protein XRCC3-like
KO
K10880
DNA-repair protein XRCC3
Organism
vem
Vollenhovia emeryi
Pathway
vem03440
Homologous recombination
Brite
KEGG Orthology (KO) [BR:
vem00001
]
09120 Genetic Information Processing
09124 Replication and repair
03440 Homologous recombination
105564246
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03400 DNA repair and recombination proteins [BR:
vem03400
]
105564246
DNA repair and recombination proteins [BR:
vem03400
]
Eukaryotic type
DSBR (double strand breaks repair)
HR (homologous recombination)
RecA family proteins
105564246
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Rad51
AAA_25
RecA
ATPase
DnaB_C
AAA_24
AAA_22
NACHT
AAA_5
LSM_int_assoc
AAA_16
SLFN-g3_helicase
AAA
PhoH
Parvo_NS1
Motif
Other DBs
NCBI-GeneID:
105564246
NCBI-ProteinID:
XP_011871872
LinkDB
All DBs
Position
Unknown
AA seq
253 aa
AA seq
DB search
MEGLLVTDAAAIRERFLTTGCARLDAKLGGGVPCRGVTQIYGAAGTGKTQLALQLCLAVQ
LPTTAGGLGAGAIYICTETTFPSRRLQQLLRNSELVKAHSVNGDVIFVDHVTTTEELVLC
LRRKVPALMNAHKIGLLIIDSIAAPYRVEDWQDQLHGKSKRLIGRQLHELCKNDDLCVIC
INQVSAVINGHRLISEDANEQPALGFTWSSMITTSIHFYRRLSQRYACVMLASHLPRITF
QFEVNESGVGATQ
NT seq
762 nt
NT seq
+upstream
nt +downstream
nt
atggagggactgctagtgacggacgcggccgcgatcagggagaggtttctgacgaccggc
tgcgcgaggctggacgcgaaactcgggggcggcgtaccctgcaggggtgtcacgcagatt
tacggcgccgccggcaccgggaagacgcagctggccctacagctatgcctcgccgtccaa
ctgccgacaaccgcgggcggcctcggagctggtgccatatatatttgtacggaaactact
ttcccctcgagacggttgcagcaactgctgagaaactcggagttagtcaaggctcattct
gtgaatggagatgtgatatttgtggaccacgtaaccacgactgaagaactggtgttgtgc
ctgcgacgcaaagtcccagcgctgatgaacgctcataagataggactgttaatcatcgac
tcgatagccgccccttacagagtagaggactggcaggaccagctacacggcaaatctaag
aggctcatcggccgacagttacacgagctttgtaaaaacgatgacctgtgcgtgatctgc
atcaaccaggtttccgcggtcataaatggtcacagactcatctccgaggacgcgaatgag
cagccggctctagggttcacgtggtcgagtatgataaccacctctatacacttttaccga
aggctctcccagcgatacgcctgcgtgatgctggcctcgcacttgccgagaatcaccttc
cagttcgaggtgaacgaatctggtgtcggggcgactcaataa
DBGET
integrated database retrieval system