Vollenhovia emeryi: 105565035 Help Entry 105565035         CDS       T06016                                  Name (RefSeq) ubiquitin-related modifier 1   KO K12161   ubiquitin related modifier 1 Organism vem  Vollenhovia emeryi Pathway vem04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:vem00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     105565035  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:vem03016]     105565035    04121 Ubiquitin system [BR:vem04121]     105565035 Transfer RNA biogenesis [BR:vem03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     105565035 Ubiquitin system [BR:vem04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    105565035 SSDB OrthologParalogGFIT Motif Pfam:  Urm1 ThiS Motif Other DBs NCBI-GeneID:  105565035 NCBI-ProteinID:  XP_011873251 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MTVPLTVEFGGGAELLFDGRKRHEVDLPGEEWTLERLLRWLRDNLLTERPELFMQGDTVR PGILVLVNDVDWELLGEGDYKLCPRDRVLFISTLHGG NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaccgtccccctcaccgtcgaattcggaggcggggcggagctgctgttcgacgggagg aagcggcacgaggtggacctacctggcgaggaatggacgctcgagcgactgctgcgttgg ctgcgggataacctcctgacggagcggccggagctcttcatgcagggcgacacggtgagg ccgggcatcctggttctggtaaacgacgtcgactgggaattgctgggtgaaggcgattat aaactgtgcccgcgggacagggtgctcttcatctcgacgctgcacggaggatag

DBGET integrated database retrieval system