Vibrio europaeus: IXK98_10760 Help Entry IXK98_10760       CDS       T07114                                  Symbol ftsB Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism veu  Vibrio europaeus Brite KEGG Orthology (KO) [BR:veu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:veu03036]     IXK98_10760 (ftsB) Chromosome and associated proteins [BR:veu03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     IXK98_10760 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC SDH_C Motif Other DBs NCBI-ProteinID:  QPG36825 LinkDB All DBs Position 1:441656..441934 Genome browser AA seq 92 aa AA seqDB search MRIFALTLTLVLGWLQFELWFGKNGISDFQAVNAETQVQHQVNGNLKTRNDEMFAEIDDL RQGLDAIEERARHELGMIKEGETFYRIVGEDN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcggatttttgcactgaccctaaccttagttttaggctggctacaatttgaactgtgg ttcggcaaaaatggtatttccgattttcaggccgtgaatgctgaaacccaagttcagcac caagttaatggcaacttaaaaactcgcaatgatgagatgtttgctgagattgatgattta cgccaagggcttgatgcgattgaagaacgcgctcgccatgagcttggtatgatcaaagaa ggggaaactttctatcgtatcgttggagaggacaattaa

DBGET integrated database retrieval system