Vibrio antiquarius: VEA_004064 Help Entry VEA_004064        CDS       T01107                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vex  Vibrio antiquarius Pathway vex01100   Metabolic pathways vex01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vex00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VEA_004064    00074 Mycolic acid biosynthesis     VEA_004064   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VEA_004064 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ACY52224 LinkDB All DBs Position 1:2727242..2727502 Genome browser AA seq 86 aa AA seqDB search MEQLHNDIKQLIIDALNLEDLTVDDIETDAPLFGDGLGLDSIDALELGLAIKKQYNIVID ADDSNTREHFASVANLAKYVSSQTNE NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtggaacagttacacaacgacattaagcaacttattattgatgctttaaaccttgaagat ttaaccgtagatgatattgaaacggatgcaccactttttggtgatggacttggcttagat tctatcgatgcacttgagcttggactcgcaattaaaaaacaatacaacatcgttattgat gccgacgactcaaacacgcgcgaacactttgcttctgtagcaaacctagcgaaatacgtt tcttctcaaactaatgaataa

DBGET integrated database retrieval system