Vibrio antiquarius: VEA_004065 Help Entry VEA_004065        CDS       T01107                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vex  Vibrio antiquarius Pathway vex01100   Metabolic pathways vex01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vex00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VEA_004065    00074 Mycolic acid biosynthesis     VEA_004065   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VEA_004065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C SID Motif Other DBs NCBI-ProteinID:  ACY52225 LinkDB All DBs Position 1:2727518..2727775 Genome browser AA seq 85 aa AA seqDB search MTDVNKDQVFEQVKDALVELFEIDAADIQSDAHLYQDLDLDSIDAVDLVVHLQNVTGKKI KPAEFSAVRTVDDVVNAVTELLKES NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgactgatgtaaataaagatcaagtatttgaacaagttaaagatgcgcttgttgagctg ttcgaaattgacgcagccgacattcagtcagatgcgcacttataccaagatctcgacctt gatagcattgacgccgttgatttggtcgtacacctacagaatgtcactggcaaaaaaatc aagccagcagagtttagtgctgtaagaaccgttgacgatgtggttaacgccgtcaccgag ttattgaaggaaagttaa

DBGET integrated database retrieval system