Vitreoscilla filiformis: VITFI_CDS0184 Help Entry VITFI_CDS0184     CDS       T04960                                  Name (GenBank) protein translocase TatA   KO K03116   sec-independent protein translocase protein TatA Organism vff  Vitreoscilla filiformis Pathway vff03060   Protein export vff03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:vff00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     VITFI_CDS0184  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     VITFI_CDS0184  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:vff02044]     VITFI_CDS0184 Secretion system [BR:vff02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    VITFI_CDS0184 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Ni_hydr_CYTB Motif Other DBs NCBI-ProteinID:  ASM75963 UniProt:  A0A221KAU3 LinkDB All DBs Position complement(188959..189189) Genome browser AA seq 76 aa AA seqDB search MGSFSIWHWLIVLVVVVLIFGTKKLKNVGSDLGSAVKGFKDGIKGGSEGVPEAPQQVTAK NDTETVDVEAKVKSKS NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgggttcgttcagcatctggcattggctgatcgtgttggtggtggtggtgctgatcttc ggcaccaagaagctcaagaacgtgggctccgatctgggttccgccgtcaagggcttcaag gatggcatcaagggcggctccgaaggcgtgcccgaagcgccgcaacaagtgaccgccaaa aacgacaccgaaacggtggacgttgaggccaaagtcaaatccaagtcctga

DBGET integrated database retrieval system