Vitreoscilla filiformis: VITFI_CDS0316
Help
Entry
VITFI_CDS0316 CDS
T04960
Name
(GenBank) 2-aminoadipate aminotransferase
KO
K05825
2-aminoadipate transaminase [EC:2.6.1.-]
Organism
vff
Vitreoscilla filiformis
Pathway
vff00300
Lysine biosynthesis
vff00630
Glyoxylate and dicarboxylate metabolism
vff01100
Metabolic pathways
vff01110
Biosynthesis of secondary metabolites
vff01210
2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:
vff00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00630 Glyoxylate and dicarboxylate metabolism
VITFI_CDS0316
09105 Amino acid metabolism
00300 Lysine biosynthesis
VITFI_CDS0316
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Aminotran_1_2
Asp_aminotransf
Motif
Other DBs
NCBI-ProteinID:
ASM76095
UniProt:
A0A221KAU4
LinkDB
All DBs
Position
337755..338927
Genome browser
AA seq
390 aa
AA seq
DB search
MNPSILREILKVTDRPGVLSLAGGLPSPHTFPVEAMREATAKVLADAPREALQYAASEGF
GPLRDWVAAHLRGMGLKVEAHQVLITTGSQQGLDLVGKVLVDSGAPVAVETPTYLGALQA
FSPFEPLFTSVASDLDGPLPDAIRALPHDAPGTRFLYVLPNFQNPTGRLMPEARRQAVIA
AAQAARVPLVEDNPYGDLWFDAPPPPPLAARWPEGVVYMGSFSKVLAPGLRLGYVVAPPE
LFPKLLQAKQAADLHTPGFNQRVVYEVIKDGFLDRHVPTIRALYKTQRDAMVQALAQHMP
AGTEWRVPQGGMFFWLRLPEGCPALALLPQAVAAGVAYVPGEPFYAHAPDSRTVRLSFVT
LTPAQIDEAVALLGHVLRRHLNEDLQAPTP
NT seq
1173 nt
NT seq
+upstream
nt +downstream
nt
atgaacccgtccatcctgcgcgaaattctcaaggtcaccgatcggcccggcgtgctctct
ttggcgggggggctgccctcgccgcacaccttcccggtcgaagccatgcgcgaagccacc
gccaaagtgttggccgacgccccacgcgaagcgctgcaatacgccgccagcgaaggtttc
ggcccgctgcgcgattgggtggccgcccacttgcgcggcatgggcttgaaggtcgaagcc
catcaggtgctcatcaccacgggctcacagcaagggctggatctggtgggcaaagtgctg
gtggacagcggggcgcccgtggccgtcgaaaccccgacttacttgggtgccctgcaagcc
ttcagcccgtttgaacctttgttcaccagtgtggccagcgacttggacggccccctgccc
gacgccatccgcgccctgccccacgatgcccccggcacccgttttttgtacgtgttgccc
aatttccaaaaccccaccgggcgcctcatgcccgaagcacgacgccaagcggtgatcgcc
gccgctcaagcggcccgcgtgccgttggtggaagacaacccttacggcgatctgtggttc
gacgccccgcccccgcccccgctggccgcacgttggccggagggggtggtgtacatggga
tcgttctccaaagtgctggcgccggggctgcgcctgggctacgtggtggcgccgccggag
ctgttccccaagctgctgcaagccaaacaagccgccgatttgcacacccccggcttcaac
cagcgggtggtgtacgaggtgatcaaagacggtttcttggatcggcacgttcccaccatc
cgcgccctctacaaaacccagcgcgatgccatggtgcaagccctggcccagcacatgccc
gctggcaccgaatggcgcgtgccacaaggcgggatgttcttctggctgcgtttgcccgaa
ggatgcccggccctggcgttgctgccccaagcggtggcggctggtgtggcctatgtgccc
ggggaaccgttctacgcccacgcgccggacagccgcaccgtgcgcctgagtttcgtcacc
ctgacccccgcacaaatcgatgaagcggtggccttgctgggccacgtgctgcgccgccat
ttgaacgaagacttgcaagcccccacgccatga
DBGET
integrated database retrieval system