Vitreoscilla filiformis: VITFI_CDS0447 Help Entry VITFI_CDS0447     CDS       T04960                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism vff  Vitreoscilla filiformis Pathway vff01100   Metabolic pathways vff01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vff00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VITFI_CDS0447    00074 Mycolic acid biosynthesis     VITFI_CDS0447   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VITFI_CDS0447 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ASM76226 UniProt:  A0A221KB40 LinkDB All DBs Position 482778..483017 Genome browser AA seq 79 aa AA seqDB search MSIEARVKKIIAEQLGVAEEEVTAEKSFVADLGADSLDTVELVMALEDEFGIEIPDEEAE KITTVKAAIDYAVANSAAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtatcgaagcacgcgtcaagaagatcattgccgagcaactgggtgttgccgaagaa gaagtcaccgctgaaaagtccttcgtggccgatctgggcgccgactcgctggacaccgtc gagctggtgatggccctggaagacgaattcggcatcgaaattcctgacgaagaggctgag aagatcaccaccgtcaaggctgccatcgactacgccgtcgccaactcggctgcggcttaa

DBGET integrated database retrieval system