Vitreoscilla filiformis: VITFI_CDS1680 Help Entry VITFI_CDS1680     CDS       T04960                                  Name (GenBank) Exodeoxyribonuclease VII   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism vff  Vitreoscilla filiformis Pathway vff03430   Mismatch repair Brite KEGG Orthology (KO) [BR:vff00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     VITFI_CDS1680  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:vff03400]     VITFI_CDS1680 Enzymes [BR:vff01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      VITFI_CDS1680 DNA repair and recombination proteins [BR:vff03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      VITFI_CDS1680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S DUF4164 BLOC1_2 CENP-Q CCDC113_CCDC96_CC MerR-DNA-bind Surfac_D-trimer Motif Other DBs NCBI-ProteinID:  ASM77458 UniProt:  A0A221KEK3 LinkDB All DBs Position 1754602..1754847 Genome browser AA seq 81 aa AA seqDB search MPDAHAPTPLPEPASYEQALAELEHLVQAMEAGRLPLDQLMNSHHRATALLAFCREQLQA LETQVQRLDASTGQLTAWSAA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgccagacgcccacgcgcccaccccgctccccgaacccgccagctacgaacaagccctg gccgagttggaacatctggtgcaggccatggaggccgggcggctgccgctggatcagctc atgaacagccaccaccgtgccaccgctttgctggcgttttgccgcgagcagttgcaagcc ctcgaaacgcaggtgcagcggctcgacgccagcaccggccaactcaccgcctggagcgcc gcatga

DBGET integrated database retrieval system