Aliivibrio fischeri ES114: VF_0955 Help Entry VF_0955           CDS       T00236                                  Symbol ybgT Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism vfi  Aliivibrio fischeri ES114 Pathway vfi00190   Oxidative phosphorylation vfi01100   Metabolic pathways vfi02020   Two-component system Module vfi_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:vfi00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     VF_0955 (ybgT)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     VF_0955 (ybgT) Enzymes [BR:vfi01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      VF_0955 (ybgT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AAW85450 UniProt:  Q5E696 LinkDB All DBs Position I:1051729..1051836 Genome browser AA seq 35 aa AA seqDB search MWYFAWILGVLLACAFGIINALWLEHSEMMDKDSE NT seq 108 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggattctaggtgttctacttgcttgtgcatttggtatcatcaat gctctttggttagagcactcagaaatgatggataaagacagtgagtaa

DBGET integrated database retrieval system