Vibrio fluvialis: AL536_00900 Help Entry AL536_00900       CDS       T04379                                  Name (GenBank) peptidylprolyl isomerase   KO K03769   peptidyl-prolyl cis-trans isomerase C [EC:5.2.1.8] Organism vfl  Vibrio fluvialis Brite KEGG Orthology (KO) [BR:vfl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:vfl03110]     AL536_00900 Enzymes [BR:vfl01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      AL536_00900 Chaperones and folding catalysts [BR:vfl03110]  Protein folding catalysts   Peptidyl prolyl isomerase    Parvulin     AL536_00900 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rotamase_3 Rotamase Rotamase_2 Ribo_biogen_C Motif Other DBs NCBI-ProteinID:  AMF92077 UniProt:  A0AAX2LXI3 LinkDB All DBs Position 1:184228..184506 Genome browser AA seq 92 aa AA seqDB search MARTAAALHILVKHKEQADDIIQQLKKGAKFQTLAKKYSLCPSGKKGGDLGEFRQGQMVP QFDKACFQGEILTPQLVKTKFGWHVVKVLYRT NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggcaagaaccgcagcagcgcttcatattctggtgaagcacaaagaacaggctgatgac atcattcagcagctaaagaaaggtgcaaagtttcagactctggccaagaaatattcactg tgtccatcgggcaaaaaaggtggcgatttgggtgagtttcgccaagggcaaatggtgcca cagtttgacaaagcgtgtttccaaggtgaaatcctcacccctcaactggtgaaaactaaa tttggctggcacgttgttaaagtgctgtaccgcacttaa

DBGET integrated database retrieval system