Vibrio fluvialis: AL536_19090 Help Entry AL536_19090       CDS       T04379                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism vfl  Vibrio fluvialis Pathway vfl02024   Quorum sensing vfl03018   RNA degradation vfl05111   Biofilm formation - Vibrio cholerae Brite KEGG Orthology (KO) [BR:vfl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     AL536_19090  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     AL536_19090    05111 Biofilm formation - Vibrio cholerae     AL536_19090  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:vfl03019]     AL536_19090    03036 Chromosome and associated proteins [BR:vfl03036]     AL536_19090 Messenger RNA biogenesis [BR:vfl03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      AL536_19090 Chromosome and associated proteins [BR:vfl03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     AL536_19090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AMF95496 UniProt:  A0AAX2LRB9 LinkDB All DBs Position 2:complement(2473199..2473462) Genome browser AA seq 87 aa AA seqDB search MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAIS TVVPARPVSHHSGERPSNDRGAEKSED NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctctacaagacccattcttaaatgcactacgtcgcgagcgtatt ccggtttcgatctaccttgtgaacggcattaagctgcaaggccaaattgaatcgtttgat cagtttgtgatcctattgaagaacactgtgaaccaaatggtttacaagcacgctatctca accgtggtaccggcgcgtccagttagccaccacagcggcgaacgtccttcgaatgatcgc ggcgcagagaaatcagaagattaa

DBGET integrated database retrieval system