Aliivibrio fischeri MJ11: VFMJ11_B0192 Help Entry VFMJ11_B0192      CDS       T00754                                  Name (GenBank) hypothetical protein   KO K03746   DNA-binding protein H-NS Organism vfm  Aliivibrio fischeri MJ11 Brite KEGG Orthology (KO) [BR:vfm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vfm03036]     VFMJ11_B0192    03400 DNA repair and recombination proteins [BR:vfm03400]     VFMJ11_B0192 Chromosome and associated proteins [BR:vfm03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     VFMJ11_B0192 DNA repair and recombination proteins [BR:vfm03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       VFMJ11_B0192 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS_N DUF3313 Motif Other DBs NCBI-ProteinID:  ACH64685 UniProt:  B5EWD6 LinkDB All DBs Position pMJ100:complement(176747..177010) Genome browser AA seq 87 aa AA seqDB search MKELKKTLLNQRSLINFARSMLTTEETQLIIERLSIYNTQRKQEEEKKQKDNEIRAEKMN QFIQQLETEGLSITDLQFHISNRNRAR NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaaagaactgaagaaaactttacttaatcaacgctcattaataaattttgctcgttca atgttaactactgaagaaacgcaacttattattgagcgtttatctatttataatacccag cgaaaacaagaagaagagaaaaaacaaaaagacaatgaaattcgagctgaaaaaatgaat caatttattcagcaattagaaactgaagggttatcaatcaccgatctgcaatttcatata tccaacagaaatcgagctcgttaa

DBGET integrated database retrieval system