Vibrio furnissii: vfu_A01526 Help Entry vfu_A01526        CDS       T01680                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism vfu  Vibrio furnissii Pathway vfu01100   Metabolic pathways vfu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:vfu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     vfu_A01526    00074 Mycolic acid biosynthesis     vfu_A01526   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     vfu_A01526 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ADT86699 LinkDB All DBs Position 1:complement(1585967..1586227) Genome browser AA seq 86 aa AA seqDB search METLHNEIKQLIIDALNLEDISIDDIDTEAPLFGDGLGLDSIDALELGLAIKKKYNIVID ADDTNTRQHFSSVANLAQYISSQTSN NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtggaaacactacacaacgaaattaaacaattgatcattgatgcactgaatctggaagat atcagcattgatgatattgatacagaagctcccctttttggagatggtttaggtctggat tcgattgatgcgcttgagcttggcttggcaatcaaaaagaaatacaacattgtgattgac gcggacgacaccaacactcgccaacatttttcatccgtcgccaatctggctcaatacatc tcatctcaaaccagtaactaa

DBGET integrated database retrieval system