KEGG   Viruses: 12218717
Entry
12218717          CDS       T40000                                 
Symbol
E7, YYS_gp2
Name
(RefSeq) Papio hamadryas papillomavirus 1; early protein E7
  KO
K21809  HPV protein E7
Taxonomy
TAX:990303
  Lineage
Viruses; dsDNA viruses; Monodnaviria; Shotokuvirae; Cossaviricota; Papovaviricetes; Zurhausenvirales; Papillomaviridae; Firstpapillomavirinae; Alphapapillomavirus; Alphapapillomavirus 11
Organism
vg  Viruses (Alphapapillomavirus 12)
SSDB
Motif
Pfam: E7
Other DBs
NCBI-GeneID: 12218717
NCBI-ProteinID: YP_006202689
RS: NC_017716
UniProt: H9LC15
LinkDB
Position
NC_017716:494..793
AA seq 99 aa
MIGPHPTLADIVLELEPEPVDLRCYEQLDSSDDEDEIDHHQQQARPVHQEDGECFRILSD
CHICQNTVSLVVYSTHDDLHVLEDLLMGNLEIVCPNCAI
NT seq 300 nt   +upstreamnt  +downstreamnt
atgattggaccccatcctactcttgcggacatagtcctagagttggaacctgaaccggtc
gatcttaggtgctatgagcaattggacagctcagatgatgaggatgaaatagaccatcat
cagcagcaagccagacctgtccatcaggaggacggggaatgtttcagaatattaagtgac
tgtcacatctgtcagaacacagtatcgctggttgtgtactctacccacgacgacctgcat
gtgttagaagacctgctgatgggcaatttggagatagtgtgtcctaactgtgccatctga

DBGET integrated database retrieval system