KEGG   Viruses: 12413920
Entry
12413920          CDS       T40000                                 

Symbol
ORF16, YOO_gp16
Name
(RefSeq) Equid alphaherpesvirus 8; envelope glycoprotein C
  KO
K19256  Simplexvirus envelope glycoprotein C
Taxonomy
TAX:39637
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Varicellovirus
Organism
vg  Viruses (Equid alphaherpesvirus 8)
SSDB
Motif
Pfam: Marek_A C1-set
Other DBs
NCBI-GeneID: 12413920
NCBI-ProteinID: YP_006272995
RS: NC_017826
UniProt: I1V8C9
LinkDB
Position
NC_017826:complement(20519..21949)
AA seq 476 aa
MWVPNLVRFVAVAYLICTGAILTYASGASASSSQSTPTTPTHTTSNLTTTPGTGSNNTTN
ANGTNSTPSSTPSIPHSHETTITCTKSLISVPYYKSVDINCTTSVGVKYSEYRLEIYLNQ
RTPFSDTPPGDKENYINHNATKDQTLLLFSTAERTKSRRAGQLGVIPDRLPKRQLFNLPL
HTEGGTKFPLTIKSVDWRTAGIYVWSLYAKNGTLVNSTSVTVSTYNAPLVDLSVHPSLKG
ENYRATCVVASYFPHSSVKLRWYKNAREVDFTKYVTNASSVWVDGLITRISTVSIPVDPE
EEYTPSLRCSIDWYRDEVSFARIAKAGTPSVFVAPTVSVVVENGDAVCTAKCVPSTGVFV
SWSVNDHLPGVPSQDITTGVCSGHSGLVNMQSRRPLSEENGEREYSCIIEGYPDGLPMFS
DTVVYDASPIVEDRPVLTSIIAITCGAAALALAVLITAVCFYCSKPSQAPYKKADF
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgtgggtgcctaatctcgtgagattcgtggcagttgcgtatctaatctgcaccggagca
atattaacttatgcctctggagctagtgctagctccagccagagtacgcccacgacacca
actcacacaacttcaaatctaacgaccacacccggtacgggctctaacaacacaactaac
gcaaacggtaccaactctacaccctcatccactccaagcatcccccactcccacgaaact
acaatcacctgcaccaaaagtctcatatctgtgccctactacaaatctgtcgatattaac
tgtacaacgtcagtaggtgtaaagtatagtgagtaccgactcgaaatttacttgaaccag
cgcaccccattttctgatacgccacccggcgacaaggaaaactacatcaaccataacgcc
accaaggatcagactctgctgttattctcaacggcggagaggacaaaatctcgaagggct
ggccagttgggagttatcccggacaggctacccaagcgccagctgtttaaccttcccctc
cacacggaaggtggtacaaagtttccactgaccatcaaatcggtagattggcgaacggcc
ggcatttacgtgtggtccttgtatgccaaaaacggcacgctcgttaacagtaccagcgtt
actgtctcaacctacaacgcaccattggttgacctttccgttcacccgagcctgaagggg
gaaaactacagggccacgtgcgtcgtcgcaagctactttccacacagctccgtaaagctg
cggtggtacaaaaatgcgcgcgaggtggactttacaaagtacgttacgaacgcctcaagc
gtgtgggtagacgggctaataacgcgaatctctacggtgtctatcccggttgatccagag
gaggaatacacccccagtcttcgctgtagcatagactggtacagggacgaagtatcattt
gctcgaatagccaaagctggcacgccctctgtgtttgtagccccaaccgtgtccgttgtg
gtagaaaatggagacgccgtctgtacggctaaatgtgtacctagcactggggtgttcgta
tcgtggtccgtgaacgaccatctaccaggggttccgtcgcaagacataacaaccggagtc
tgctcgggccactcgggattggtcaacatgcaaagccgccgacccctctcagaagaaaat
ggggagagggagtatagctgcataatagaggggtacccagacggcctgcctatgttctca
gacacagtggtgtatgacgcctccccaattgttgaggacaggccggttttgacgagcatt
atcgcaattacttgcggggctgcggcgctggcgctggccgttctaatcacagccgtctgt
ttttactgctccaaaccctcgcaggcgccgtacaagaaggctgacttttag

DBGET integrated database retrieval system