KEGG   Viruses: 1403313
Entry
1403313           CDS       T40000                                 
Symbol
E7, HpV61gp2
Name
(RefSeq) Alphapapillomavirus 3; transforming protein E7
  KO
K21809  HPV protein E7
Taxonomy
TAX:333767
  Lineage
Viruses; dsDNA viruses; Monodnaviria; Shotokuvirae; Cossaviricota; Papovaviricetes; Zurhausenvirales; Papillomaviridae; Firstpapillomavirinae; Alphapapillomavirus
Organism
vg  Viruses (Alphapapillomavirus 3)
SSDB
Motif
Pfam: E7 Dehyd-heme_bind
Other DBs
NCBI-GeneID: 1403313
NCBI-ProteinID: NP_043445
RS: NC_001694
UniProt: Q80949
LinkDB
Position
NC_001694:518..805
AA seq 95 aa
MHGQVATIKDIVLEERPEVVDLHCNEQLLDSSESEEEDSVREQLVEQAQQAYRVVTTCGI
CKCPVRLVVQCGDADLKVLHELLLGDLSIVCPGCA
NT seq 288 nt   +upstreamnt  +downstreamnt
atgcacggccaggtggcaaccataaaggacatagtccttgaagagcgtcctgaggtggtt
gacctacattgcaatgagcagttattagacagctcagagtcagaggaggaggatagtgtg
cgtgagcaacttgttgaacaagcacagcaggcctacagggtggttactacctgtggcatt
tgtaagtgtccagttaggctggtggtgcagtgcggagacgcagacctgaaggtgctacat
gaactactgctgggcgacttgtccatagtgtgtcctggctgcgcataa

DBGET integrated database retrieval system