KEGG   Viruses: 1487579
Entry
1487579           CDS       T40000                                 

Symbol
ORF16, EhV4gp16
Name
(RefSeq) Equid alphaherpesvirus 4; envelope glycoprotein C
  KO
K19256  Simplexvirus envelope glycoprotein C
Taxonomy
TAX:10331
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Varicellovirus
Organism
vg  Viruses (Equid alphaherpesvirus 4)
SSDB
Motif
Pfam: Marek_A C1-set
Other DBs
NCBI-GeneID: 1487579
NCBI-ProteinID: NP_045233
RS: NC_001844
UniProt: A0A0X9Z9E5 A0A288CG00
LinkDB
Position
NC_001844:complement(20939..22396)
AA seq 485 aa
MGLVNIMRFITFAYIICGGFILTRTSGTSASASPATPTTNTGEGTSSPVTPTYTTSTDSN
NSTATNNSTDVNGTEATPTPSHPHSHENTITCTNSLISVPYYTSVTINCSTTVSVNHSEY
RLEIHLNQRTPFSDTPPGDQENYVNHNATKDQTLLLFSTAHSSAKSRRVGQLGVIPDRLP
KRQLFNLPAHTNGGTNFPLNIKSIDWRTAGVYVWYLFAKNGSLINSTSVTVLTYNAPLMD
LSVHPSLKGENHRAVCVVASYFPHNSVKLRWYKNAKEVDFTKYVTNASSVWVDGLITRIS
TVSIPADPDEEYPPSLRCSIEWYRDEVSFSRMAKAGTPSVFVAPTVSVNVEDGAAVCTAE
CVPSNGVFVSWVVNDHLPGVPSQDVTTGVCSSHPGLVNMRSSRPLSEENGEREYNCIIEG
YPDGLPMFSDSVVYDASPIVEDMPVLTSIIAVTCGAAALALVVLITAVCFYCSKPSQVPY
KKADF
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgggtttggtaaatataatgcgattcataacatttgcgtatataatctgtggggggttt
atattaacacgcacgtctgggaccagtgctagcgccagtccagccacaccaaccacaaat
actggcgaaggcaccagttctccagtcacaccaacttacacaaccagtacggactctaat
aattcaacagccacgaacaactcaaccgatgtaaacggcaccgaagctacaccaacgccg
agtcacccacattcacatgaaaatacaattacatgcacaaatagtctcatatcggttccc
tactacacatctgttaccattaactgttctacaacagtaagtgtaaatcacagtgaatac
agactagaaattcacctaaaccagcgcaccccattttcagacacgcctcctggtgaccaa
gaaaactatgttaaccacaacgctaccaaagaccaaaccctgctgttattttcaaccgca
cattctagcgcgaaatctcgaagggttggccagctgggcgttattccagacaggctacct
aagcgtcaactgttcaacctcccggcccacacgaacggtggtacaaattttccactaaac
ataaaatctatagactggcgtaccgcgggagtttatgtgtggtacttgtttgccaaaaac
ggctcactcattaacagtaccagcgttaccgtgttaacgtacaacgcacccctaatggac
ctctccgttcacccaagtttgaagggtgaaaaccacagagccgtgtgcgtagttgctagc
tactttccccacaactctgttaagctgaggtggtataaaaacgccaaagaggttgatttt
acaaagtatgttaccaatgcttctagtgtgtgggtggatggtctcatcactcgcatctcg
actgtatcaatcccagctgaccccgacgaagaatatccccccagcctccgctgtagcata
gaatggtacagagacgaggtatccttttctcgcatggccaaagcaggcacgccctctgtg
ttcgtggccccaaccgtgtccgtaaacgttgaagatggtgcagcagtttgtacggcagaa
tgtgtacctagcaacggagtgtttgtatcgtgggtcgttaacgaccatttaccgggggtc
ccatcacaagacgtaacaacgggagtttgctcaagccacccaggattagtcaacatgcgg
agtagcaggcccctgtcggaagaaaacggagagcgagagtataactgcatcatagagggt
tacccggacggccttccaatgttttctgacagcgttgtatatgatgcatcccctattgtt
gaggacatgcccgttttaactagcatcatcgccgttacttgcggggccgcagcgctagcg
ctggttgttctcattacagccgtttgtttttactgctcaaaaccctcgcaggtgccgtac
aagaaagcagacttctaa

DBGET integrated database retrieval system