KEGG   Viruses: 1489007
Entry
1489007           CDS       T40000                                 
Symbol
E7, RmpVgp2
Name
(RefSeq) Alphapapillomavirus 12; E7 protein
  KO
K21809  HPV protein E7
Taxonomy
TAX:10570
  Lineage
Viruses; dsDNA viruses; Monodnaviria; Shotokuvirae; Cossaviricota; Papovaviricetes; Zurhausenvirales; Papillomaviridae; Firstpapillomavirinae; Alphapapillomavirus
Organism
vg  Viruses (Alphapapillomavirus 12)
SSDB
Motif
Pfam: E7 zf_C2H2_13
Other DBs
NCBI-GeneID: 1489007
NCBI-ProteinID: NP_043332
RS: NC_001678
UniProt: P22161
LinkDB
Position
NC_001678:594..935
AA seq 113 aa
MIGPKPTLEDIVLDLQPFPQPQPVDLMCYEQLSDSSEDEDEVDHHHNNQQQHHQHARPEV
PEDGDCYRIVSDCYSCGKPLRLVVVSSHEELRVLEDLLMGTLDIVCPSCASRV
NT seq 342 nt   +upstreamnt  +downstreamnt
atgattgggcctaaacctaccctcgaggacattgtcctagatttgcaaccatttccacaa
ccgcaaccggtcgaccttatgtgttatgagcaattatctgacagctcagaggatgaggat
gaagtagaccatcatcacaataatcagcagcagcatcatcagcacgccagacctgaagta
ccagaggatggtgattgttatagaattgtgagcgattgttacagctgtggcaagccactg
aggctggttgtggttagtagccacgaagagttacgtgtgctagaggacctgctgatgggc
acgcttgacattgtgtgtcccagctgtgccagcagagtgtaa

DBGET integrated database retrieval system