KEGG   Viruses: 1489079
Entry
1489079           CDS       T40000                                 
Symbol
E7, HpV16gp2
Name
(RefSeq) Human papillomavirus type 16; transforming protein E7
  KO
K21809  HPV protein E7
Taxonomy
TAX:333760 [GN:T40087]
  Lineage
Viruses; dsDNA viruses; Monodnaviria; Shotokuvirae; Cossaviricota; Papovaviricetes; Zurhausenvirales; Papillomaviridae; Firstpapillomavirinae; Alphapapillomavirus; Alphapapillomavirus 9
Organism
vg  Viruses (Alphapapillomavirus 9)
SSDB
Motif
Pfam: E7
Other DBs
NCBI-GeneID: 1489079
NCBI-ProteinID: NP_041326
RS: NC_001526
UniProt: P03129 A0A384LCP1 A0A160CE21 Q77GV7 Q778I1 Q547B8 Q778G9 A0A2P0VGD6 Q77AI1 A0A2P0VGZ1 A0A2P0VIV5 Q778G6 A0A2P0VHY3 Q778I3 Q778I0 Q778G8 Q778H7 A0A2P0VHY0 A0A2P0VHG2 Q778H1 A0A2P0VKC6 Q778H9 Q778I5 A0A2P0VGD7 A0A0H4CQU3 Q778G4 Q778H2 A0A2P0VJU6 A0A2P0VHG5
Structure
LinkDB
Position
NC_001526:7604..7900
AA seq 98 aa
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCK
CDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
NT seq 297 nt   +upstreamnt  +downstreamnt
atgcatggagatacacctacattgcatgaatatatgttagatttgcaaccagagacaact
gatctctactgttatgagcaattaaatgacagctcagaggaggaggatgaaatagatggt
ccagctggacaagcagaaccggacagagcccattacaatattgtaaccttttgttgcaag
tgtgactctacgcttcggttgtgcgtacaaagcacacacgtagacattcgtactttggaa
gacctgttaatgggcacactaggaattgtgtgccccatctgttctcagaaaccataa

DBGET integrated database retrieval system