KEGG   Viruses: 1489087
Entry
1489087           CDS       T40000                                 
Symbol
E5, HpV18gp6
Name
(RefSeq) Alphapapillomavirus 7; E5 protein
  KO
K21812  HPV protein E5
Taxonomy
TAX:337042 [GN:T40088]
  Lineage
Viruses; dsDNA viruses; Monodnaviria; Shotokuvirae; Cossaviricota; Papovaviricetes; Zurhausenvirales; Papillomaviridae; Firstpapillomavirinae; Alphapapillomavirus
Organism
vg  Viruses (Alphapapillomavirus 7)
SSDB
Motif
Pfam: Papilloma_E5
Other DBs
NCBI-GeneID: 1489087
NCBI-ProteinID: NP_040315
RS: NC_001357
UniProt: P06792
LinkDB
Position
NC_001357:3936..4157
AA seq 73 aa
MLSLIFLFCFCVCMYVCCHVPLLPSVCMCAYAWVLVFVYIVVITSPATAFTVYVFCFLLP
MLLLHIHAILSLQ
NT seq 222 nt   +upstreamnt  +downstreamnt
atgttatcacttatttttttattttgcttttgtgtatgcatgtatgtgtgctgccatgtc
ccgcttttgccatctgtctgtatgtgtgcgtatgcatgggtattggtatttgtgtatatt
gtggtaataacgtcccctgccacagcattcacagtatatgtattttgttttttattgccc
atgttactattgcatatacatgctatattgtctttacagtaa

DBGET integrated database retrieval system