KEGG   Viruses: 1489089
Entry
1489089           CDS       T40000                                 
Symbol
E7, HpV18gp2
Name
(RefSeq) Alphapapillomavirus 7; E7 protein
  KO
K21809  HPV protein E7
Taxonomy
TAX:337042 [GN:T40088]
  Lineage
Viruses; dsDNA viruses; Monodnaviria; Shotokuvirae; Cossaviricota; Papovaviricetes; Zurhausenvirales; Papillomaviridae; Firstpapillomavirinae; Alphapapillomavirus
Organism
vg  Viruses (Alphapapillomavirus 7)
SSDB
Motif
Pfam: E7
Other DBs
NCBI-GeneID: 1489089
NCBI-ProteinID: NP_040311
RS: NC_001357
LinkDB
Position
NC_001357:590..907
AA seq 105 aa
MHGPKATLQDIVLHLEPQNEIPVDLLCHEQLSDSEEENDEIDGVNHQHLPARRAEPQRHT
MLCMCCKCEARIELVVESSADDLRAFQQLFLNTLSFVCPWCASQQ
NT seq 318 nt   +upstreamnt  +downstreamnt
atgcatggacctaaggcaacattgcaagacattgtattgcatttagagccccaaaatgaa
attccggttgaccttctatgtcacgagcaattaagcgactcagaggaagaaaacgatgaa
atagatggagttaatcatcaacatttaccagcccgacgagccgaaccacaacgtcacaca
atgttgtgtatgtgttgtaagtgtgaagccagaattgagctagtagtagaaagctcagca
gacgaccttcgagcattccagcagctgtttctgaacaccctgtcctttgtgtgtccgtgg
tgtgcatcccagcagtaa

DBGET integrated database retrieval system