KEGG   Viruses: 1489226
Entry
1489226           CDS       T40000                                 
Symbol
E7, HpV2agp2
Name
(RefSeq) Alphapapillomavirus 4; early protein E7
  KO
K21809  HPV protein E7
Taxonomy
TAX:337043 [GN:T40109]
  Lineage
Viruses; dsDNA viruses; Monodnaviria; Shotokuvirae; Cossaviricota; Papovaviricetes; Zurhausenvirales; Papillomaviridae; Firstpapillomavirinae; Alphapapillomavirus
Organism
vg  Viruses (Alphapapillomavirus 4)
SSDB
Motif
Pfam: E7 zf-C2HC_2
Other DBs
NCBI-GeneID: 1489226
NCBI-ProteinID: NP_077117
RS: NC_001352
LinkDB
Position
NC_001352:529..807
AA seq 92 aa
MHGNRPSLKDITLILDEIPEIVDLHCDEQFDSSEEENNHQLTEPDVQAYGVVTTCCKCGR
TVRLVVECGQADLRELEQLFLKTLTLVCPHCA
NT seq 279 nt   +upstreamnt  +downstreamnt
atgcacggcaaccgacccagcctcaaggacattacactaatattggatgaaatacccgaa
attgttgacctacattgcgacgagcaatttgacagctcagaagaagagaataaccatcaa
ctgacagaaccagatgtgcaggcctacggggtggtaactacctgctgtaagtgtggcaga
accgtccggctggtggttgagtgcggacaagcagacctaagagagctggaacagctgttc
ttgaagacgctgactctagtgtgccctcactgcgcctag

DBGET integrated database retrieval system