KEGG   Viruses: 1489376
Entry
1489376           CDS       T40000                                 
Symbol
E7, HpV10gp2
Name
(RefSeq) Human papillomavirus type 10; envelope protein
  KO
K21809  HPV protein E7
Taxonomy
TAX:333759 [GN:T40098]
  Lineage
Viruses; dsDNA viruses; Monodnaviria; Shotokuvirae; Cossaviricota; Papovaviricetes; Zurhausenvirales; Papillomaviridae; Firstpapillomavirinae; Alphapapillomavirus; Alphapapillomavirus 2
Organism
vg  Viruses (Alphapapillomavirus 2)
SSDB
Motif
Pfam: E7 zf-CSL zinc-ribbons_6 AsnC_trans_reg Integrase_Zn
Other DBs
NCBI-GeneID: 1489376
NCBI-ProteinID: NP_041742
RS: NC_001576
UniProt: P36818
LinkDB
Position
NC_001576:524..784
AA seq 86 aa
MHGPHPTVKDIELSLAPEDIPVCNVQLDEEDYTDAVEPAQQAYRVVTECTKCSLPLRLVV
ECSHADIRALEQLLLGTLKLVCPRCV
NT seq 261 nt   +upstreamnt  +downstreamnt
atgcacggtccgcatcccacagtaaaagatatcgaattgagtcttgcaccagaggatatc
cctgtatgcaatgtgcaattagatgaagaagattatacagatgcggtggaaccagcacaa
caagcgtatagggtggtaacagaatgtacaaagtgtagtttaccactgcgactggtggta
gagtgcagccacgcagatataagggcactggaacagctgctactaggcacattgaagctc
gtgtgtcctcgctgcgtgtaa

DBGET integrated database retrieval system