KEGG   Viruses: 1489425
Entry
1489425           CDS       T40000                                 
Symbol
E7, HpV32gp2
Name
(RefSeq) Human papillomavirus type 32; early protein
  KO
K21809  HPV protein E7
Taxonomy
TAX:333763
  Lineage
Viruses; dsDNA viruses; Monodnaviria; Shotokuvirae; Cossaviricota; Papovaviricetes; Zurhausenvirales; Papillomaviridae; Firstpapillomavirinae; Alphapapillomavirus; Alphapapillomavirus 1
Organism
vg  Viruses (Alphapapillomavirus 1)
SSDB
Motif
Pfam: E7
Other DBs
NCBI-GeneID: 1489425
NCBI-ProteinID: NP_041802
RS: NC_001586
UniProt: P36827 A0A0U3BXY4
LinkDB
Position
NC_001586:530..844
AA seq 104 aa
MRGNAPTLKDIILYDLPTCDPTTCDTPPVDLYCYEQFDTSDEDDEDDDQPIKQDIQRYRI
VCGCTQCGRSVKLVVSSTGADIQQLHQMLLDTLGIVCPLCACVE
NT seq 315 nt   +upstreamnt  +downstreamnt
atgcgtggaaacgcaccaacgctaaaggacattattttgtatgacctgccaacgtgtgac
ccgacaacgtgcgacacaccgccggttgacctgtattgttatgaacaatttgacacctca
gatgaagatgatgaagacgatgaccaacctataaaacaggacatacaacgttacagaata
gtgtgtggttgtacacagtgtggacggtcagttaaacttgttgtcagtagtacaggcgcg
gacatacaacagctgcatcagatgcttctggacacactgggcattgtgtgtccattgtgt
gcctgcgtggagtga

DBGET integrated database retrieval system