KEGG   Viruses: 1489465
Entry
1489465           CDS       T40000                                 
Symbol
E7, HpV53gp2
Name
(RefSeq) Human papillomavirus type 53; early protein
  KO
K21809  HPV protein E7
Taxonomy
TAX:333765
  Lineage
Viruses; dsDNA viruses; Monodnaviria; Shotokuvirae; Cossaviricota; Papovaviricetes; Zurhausenvirales; Papillomaviridae; Firstpapillomavirinae; Alphapapillomavirus; Alphapapillomavirus 6
Organism
vg  Viruses (Alphapapillomavirus 6)
SSDB
Motif
Pfam: E7
Other DBs
NCBI-GeneID: 1489465
NCBI-ProteinID: NP_041845
RS: NC_001593
UniProt: P36832 Q17UH0 G8HXR1 G8HXR7 G8HXS4 G8HXS1 G8HXR3 G8HXS3 G8HXR9 G8HXS7 G8HXQ9 G8HXT1 G8HXQ6 G8HXS0 G8HXT0 G8HXS8 G8HXR5 G8HXR4 G8HXR2 G8HXQ7
LinkDB
Position
NC_001593:569..886
AA seq 105 aa
MHGNVPTLPQYIIELIPQTEIDLQCHEQLNSSEDEDEDEVDHLQEQPQQARRDEQHPCYL
IETQCCRCESLVQLAVQSSTKELRILQQMLMGTVELVCPLCATRR
NT seq 318 nt   +upstreamnt  +downstreamnt
atgcacggtaacgtaccaacacttccacaatatattatagaacttataccacaaactgag
attgacctgcaatgccatgagcaattgaacagctcagaggatgaggatgaggatgaagta
gaccatctgcaggagcagccacagcaagctagacgggacgaacaacatccttgttaccta
attgaaacacagtgttgtaggtgtgagtcgttggtgcagttggctgttcagagttcaaca
aaagagctgcgtattttacaacaaatgcttatgggcacagtggagcttgtgtgccccctc
tgcgcaacaaggcgataa

DBGET integrated database retrieval system