KEGG   Viruses: 1489673
Entry
1489673           CDS       T40000                                 

Symbol
ORF6, sars6
Name
(RefSeq) SARS coronavirus Tor2; ORF6 protein
  KO
K24580  SARS coronavirus accessory protein 6
Taxonomy
TAX:227984 [GN:T40069]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Sarbecovirus; Severe acute respiratory syndrome-related coronavirus
Organism
vg  Viruses (Severe acute respiratory syndrome-related coronavirus)
SSDB
Motif
Pfam: bCoV_NS6
Other DBs
NCBI-GeneID: 1489673
NCBI-ProteinID: YP_009825056
RS: NC_004718
LinkDB
Position
NC_004718:27074..27265
AA seq 63 aa
MFHLVDFQVTIAEILIIIMRTFRIAIWNLDVIISSIVRQLFKPLTKKNYSELDDEEPMEL
DYP
NT seq 192 nt   +upstreamnt  +downstreamnt
atgtttcatcttgttgacttccaggttacaatagcagagatattgattatcattatgagg
actttcaggattgctatttggaatcttgacgttataataagttcaatagtgagacaatta
tttaagcctctaactaagaagaattattcggagttagatgatgaagaacctatggagtta
gattatccataa

DBGET integrated database retrieval system