KEGG   Viruses: 1489798
Entry
1489798           CDS       T40000                                 
Symbol
CDVgp1
Name
(RefSeq) Canine morbillivirus; nucleocapsid protein N
  KO
K19380  Morbillivirus nucleoprotein
Taxonomy
TAX:11232
  Lineage
Viruses; -ssRNA viruses; Riboviria; Orthornavirae; Negarnaviricota; Haploviricotina; Monjiviricetes; Mononegavirales; Paramyxoviridae; Orthoparamyxovirinae; Morbillivirus
Organism
vg  Viruses (Canine morbillivirus)
SSDB
Motif
Pfam: Paramyxo_ncap Ebola_NP
Other DBs
NCBI-GeneID: 1489798
NCBI-ProteinID: NP_047201
RS: NC_001921
UniProt: P04865 A0A1X9RKA4
LinkDB
Position
NC_001921:108..1679
AA seq 523 aa
MASLLKSLTLFKRTRDQPPLASGSGGAIRGIKHVIIVLIPGDSSIVTRSRLLDRLVRLVG
DPKINGPKLTGILISILSLFVESPGQLIQRIIDDPDVSIKLVEVIPSINSACGLTFASRG
ASLDSEADEFFKIVDEGSKAQGQLGWLENKDIVDIEVDNAEQFNILLASILAQIWILLAK
AVTAPDTAADSEMRRWIKYTQQRRVVGEFRMNKIWLDIVRNRIAEDLSLRRFMVALILDI
KRSPGNKPRIAEMICDIDNYIVEAGLASFILTIKFGIETMYPALGLHEFSGELTTIESLM
MLYQQMGETAPYMVILENSVQNKFSAGSYPLLWSYAMGVGVELENSMGGLNFGRSYFDPA
YFRLGQEMVRRSAGKVSSALAAELGITKEEAQLVSEIASKTTEDRTIRATGPKQSQITFL
HSERSEVANQQPPTINKRSENQGGDKYPIHFSDERLPGYTPDVNSSEWSESRYDTQIIQD
DGNDDDRKSMEAIAKMRMLTKMLSQPGTSEDNSPVYSDKELLN
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggctagccttcttaaaagcctcacactgttcaagaggactcgggaccaaccccctctt
gcctctggctccgggggagcaataagaggaataaagcatgtcattatagtcctaatcccg
ggtgattcaagcattgttacaagatctcgactattggatagacttgttaggttggttggt
gatccaaaaatcaacggccctaaattaactgggatcttaatcagtatcctctccttgttt
gtggaatcccctggacagttgatccagaggatcatagacgaccctgatgtaagcatcaag
ttagtagaggtaataccaagcatcaactctgcttgcggtcttacatttgcatccagagga
gcaagtctggattctgaggcagatgagttcttcaaaattgtagacgaagggtcgaaagct
caagggcaattaggctggttagagaataaggatatagtagacatagaagttgataatgct
gagcaattcaatatattgctagcttccatcttggctcaaatttggatcctgctagctaaa
gcggtgactgctcctgatactgcagccgactcggagatgagaaggtggattaagtatacc
cagcaaagacgtgtggtcggagaatttagaatgaacaaaatctggcttgatattgttaga
aacaggattgctgaggacctatctttgaggcgattcatggtggcgctcatcttggacatc
aaacgatccccagggaacaagcctagaattgctgaaatgatttgtgatatagataactac
attgtggaagctgggttagctagtttcatcctaactatcaagtttggcattgaaactatg
tatccggctcttgggttgcatgagttttccggagaattaacaactattgaatccctcatg
atgctatatcaacagatgggtgaaacagcaccgtacatggttatcttggaaaactctgtt
caaaacaaatttagtgcagggtcctacccattgctctggagttatgctatgggggttggt
gttgaacttgaaaactccatgggagggttaaatttcggtcgatcttactttgacccagct
tacttcagactcgggcaagaaatggttaggagatctgccggcaaagtaagctctgcactt
gccgccgagcttggcatcaccaaggaggaagctcagctagtgtcagaaatagcatccaag
acaacagaggaccggacaattcgagctactggtcctaagcaatcccaaatcacttttctg
cactcggaaagatccgaagtcgccaatcaacaacccccaaccatcaacaagaggtccgaa
aaccagggaggagacaaataccccattcacttcagtgacgaaaggcttccagggtatacc
ccagatgtcaacagttctgaatggagtgagtcacgctatgacacccaaattatccaagat
gatggaaatgacgatgatcggaaatcgatggaagcaatcgccaagatgaggatgcttact
aagatgctcagtcaacctgggaccagtgaagataattctcctgtttatagtgataaagag
ctactcaattaa

DBGET integrated database retrieval system